GPR54 Antibody / KISS1R

NSJ Bioreagents
Product Code: NSJ-RQ4294
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4294-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the GPR54 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human 1) WISH and 2) HepG2 cell lysate with GPR54 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.

Western blot testing of human 1) WISH and 2) HepG2 cell lysate with GPR54 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the GPR54 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds the peptide hormone kisspeptin (metastin). Kisspeptin is involved in the regulation of endocrine function and the onset of puberty, with activation of the kisspeptin receptor triggering release of gonadotropin-releasing hormone (GnRH), and release of kisspeptin itself being inhibited by oestradiol but enhanced by GnRH. Reductions in kisspeptin levels with age may conversely be one of the reasons behind age-related declines in levels of other endocrine hormones such as luteinizing hormone.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK were used as the immunogen for the GPR54 antibody.
Limitation:
This GPR54 antibody is available for research use only.
Localization:
Cell membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q969F8