Gremlin 1 Antibody
| Code | Size | Price |
|---|
| NSJ-R31825-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the Gremlin 1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the Gremlin 1 antibody should be determined by the researcher.
Description:
Gremlin, also known as Drm, is a highly conserved 20.7-kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD of human Gremlin 1 were used as the immunogen for the Gremlin 1 antibody.
Limitation:
This Gremlin 1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
O60565