GRK2 Antibody / Beta-adrenergic receptor kinase 1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4087
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4087-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the GRK2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with GRK2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC staining of FFPE human lung cancer with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE mouse spleen with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE rat spleen with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
5 / 6
Western blot testing of 1) rat spleen, 2) rat stomach, 3) mouse lung, 4) mouse liver and 5) mouse pancreas lysate wtih GRK2 antibody at 0.5ug/ml. Predicted molecular weight ~79 kDa.
6 / 6
Flow cytometry testing of human U-87 MG cells with GRK2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GRK2 antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with GRK2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human lung cancer with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE mouse spleen with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat spleen with GRK2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Western blot testing of 1) rat spleen, 2) rat stomach, 3) mouse lung, 4) mouse liver and 5) mouse pancreas lysate wtih GRK2 antibody at 0.5ug/ml. Predicted molecular weight ~79 kDa.
Flow cytometry testing of human U-87 MG cells with GRK2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GRK2 antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the GRK2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Beta adrenergic receptor kinase (also referred to as beta-ARK or BARK) is a serine/threonine intracellular kinase. The product of this gene phosphorylates the beta-2-adrenergic receptor and appears to mediate agonist-specific desensitization observed at high agonist concentrations. This protein is an ubiquitous cytosolic enzyme that specifically phosphorylates the activated form of the beta-adrenergic and related G-protein-coupled receptors. Abnormal coupling of beta-adrenergic receptor to G protein is involved in the pathogenesis of the failing heart.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK from the human protein were used as the immunogen for the GRK2 antibody.
Limitation:
This GRK2 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P25098