GSTA Antibody (alpha 1-5)

Contact us
NSJ Bioreagents
Product Code: NSJ-R31915
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31915-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the GSTA antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Immunofluorescent staining of FFPE rat liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
2 / 3
Immunofluorescent staining of FFPE mouse liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 3
Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat liver, 4) rat RH35 and 5) mouse liver tissue lysate with GSTA antibody. Predicted molecular weight ~25 kDa.
❮❯

Immunofluorescent staining of FFPE rat liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Immunofluorescent staining of FFPE mouse liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat liver, 4) rat RH35 and 5) mouse liver tissue lysate with GSTA antibody. Predicted molecular weight ~25 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunofluorescence (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the GSTA antibody should be determined by the researcher.
Description:
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE of human GSTA(1-5) were used as the immunogen for the GSTA antibody.
Limitation:
This GSTA antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P08263