HER2 / ErbB 2Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32662
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32662-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the HER2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with HER2 antibody. Predicted molecular weight ~138 kDa (unmodified), ~185 kDa (glycosylated).
2 / 4
Western blot testing of human HepG2 cell lysate with HER2 antibody. Predicted molecular weight ~138 kDa (unmodified), ~185 kDa (glycosylated).
3 / 4
IHC testing of FFPE breast cancer tissue with HER2 antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
4 / 4
IHC testing of FFPE human liver cancer tissue with HER2 antibody. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
❮❯

Western blot testing of human 1) HeLa and 2) MCF7 cell lysate with HER2 antibody. Predicted molecular weight ~138 kDa (unmodified), ~185 kDa (glycosylated).
Western blot testing of human HepG2 cell lysate with HER2 antibody. Predicted molecular weight ~138 kDa (unmodified), ~185 kDa (glycosylated).
IHC testing of FFPE breast cancer tissue with HER2 antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFPE human liver cancer tissue with HER2 antibody. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the HER2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 29-64 (TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY) from the human protein were used as the immunogen for the HER2 antibody.
Limitation:
This HER2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P04626