HKDC1 Antibody

NSJ Bioreagents
Product Code: NSJ-R32256
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32256-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the HKDC1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human 1) 293, 2) SW620, 3) COLO320 and 4) HeLa cell lysate with HKDC1 antibody. Expected molecular weight: ~103 kDa, observed here at ~170 kDa.

Western blot testing of human 1) 293, 2) SW620, 3) COLO320 and 4) HeLa cell lysate with HKDC1 antibody. Expected molecular weight: ~103 kDa, observed here at ~170 kDa.

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the HKDC1 antibody should be determined by the researcher.
Description:
HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.
Limitation:
This HKDC1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q2TB90