HSP90 beta Antibody / HSP90AB1

Contact us
NSJ Bioreagents
Product Code: NSJ-R31913
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31913-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the HSP90 beta antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 9
Western blot testing of 1) rat testis, 2) rat thymus, 3) human placenta, 4) SW620 and 5) HeLa lysate with HSP90 beta antibody. Expected/observed molecular weight: 84-90 kDa.
2 / 9
IHC testing of FFPE human placenta with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 9
IHC testing of FFPE mouse testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 9
IHC testing of FFPE rat testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 9
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
6 / 9
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
7 / 9
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
8 / 9
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
9 / 9
IF/ICC staining of FFPE human A431 cells with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
❮❯

Western blot testing of 1) rat testis, 2) rat thymus, 3) human placenta, 4) SW620 and 5) HeLa lysate with HSP90 beta antibody. Expected/observed molecular weight: 84-90 kDa.
IHC testing of FFPE human placenta with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IF/ICC staining of FFPE human A431 cells with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml
Application Note:
Optimal dilution of the HSP90 beta antibody should be determined by the researcher.
Description:
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.
Limitation:
This HSP90 beta antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P08238