IGFBP1 Antibody
| Code | Size | Price |
|---|
| NSJ-R32108-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Mouse
- Rat
Applications:
- Enzyme-Linked Immunosorbent Assay (ELISA)
- Western Blot (WB)
Storage:
After reconstitution, the IGFBP1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml
Application Note:
Optimal dilution of the IGFBP1 antibody should be determined by the researcher.
Description:
IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids REIADLKKWKEPCQRELYKVLERLAAAQQKA of mouse IGFBP1 were used as the immunogen for the IGFBP1antibody.
Limitation:
This IGFBP1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
P47876