IL1 beta Antibody

Western Blot: 0.5-1ug/ml

Optimal dilution of the IL1B antibody should be determined by the researcher.

Lyophilized from 1X PBS with 2% Trehalose

Interleukin-1 beta (IL-1b) is a potent stimulator of bone resorption whose gene is mapped to 2q14, and has been implicated in the pathogenesis of high bone turnover and osteoporosis. IL-1b, a prominent microglia-derived cytokine, caused oligodendrocyte death in coculture with astrocytes and microglia, but not in pure culture of oligodendrocytes alone. It also can cause nuclear export of a specific NCOR corepressor complex, resulting in derepression of a specific subset of nuclear factor-kappa-B (NFKB)-regulated genes. Furthermore, Microenvironmental IL-1b and, to a lesser extent, IL-1? are required for in vivo angiogenesis and invasiveness of different tumor cells. Additional, the cooperation of IL-1b and PDGFB induces contractile-to-synthetic phenotype modulation of human aortic smooth muscle cells in culture. Moreover, the association with disease may be explained by the biologic properties of IL-1b, which is an important proinflammatory cytokine and a powerful inhibitor of gastric acid secretion.

Antigen affinity purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Amino acids DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE were used as the immunogen for the IL1B antibody.

This IL1B antibody is available for research use only.

Antigen affinity

Mouse, Rat

P10749