ITLN1 Antibody / Intelectin-1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32441
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32441-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
Prior to reconstitution, store at 40. After reconstitution, the ITLN1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Immunofluorescent staining of FFPE human U-2 OS cells with ITLN1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
IHC testing of FFPE human intestinal cancer tissue with ITLN1 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
3 / 4
Western blot testing of human SW620 cell lysate with ITLN1 antibody at 0.5ug/ml. Expected molecular weight: 35-40 kDa.
4 / 4
Flow cytometry testing of human U937 cells with ITLN1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ITLN1 antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with ITLN1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer tissue with ITLN1 antibody at 1ug/ml. HIER: steam in pH6 citrate buffer and allow to cool prior to staining.
Western blot testing of human SW620 cell lysate with ITLN1 antibody at 0.5ug/ml. Expected molecular weight: 35-40 kDa.
Flow cytometry testing of human U937 cells with ITLN1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ITLN1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR were used as the immunogen for the ITLN1 antibody.
Limitation:
This ITLN1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q8WWA0