KIM-1 Antibody / TIM-1 / HAVCR1

NSJ Bioreagents
Product Code: NSJ-R32305
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32305-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the KIM1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human 1) HeLa, 2) PANC, 3) HepG2 and 4) A549 cell lysate with KIM1 antibody. Predicted molecular weight ~39 kDa, routinely observed at ~55 kDa. (Ref 1)

Western blot testing of human 1) HeLa, 2) PANC, 3) HepG2 and 4) A549 cell lysate with KIM1 antibody. Predicted molecular weight ~39 kDa, routinely observed at ~55 kDa. (Ref 1)

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the KIM1 antibody should be determined by the researcher.
Description:
Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt]
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Limitation:
This KIM1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q96D42