KPNA2 Antibody (N-Terminal Region)

Western Blot: 0.5-1ug/ml

Optimal dilution of the KPNA2 antibody should be determined by the researcher.

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V(D)J recombination.

Antigen affinity purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Amino acids 2-46 (STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQ) were used as the immunogen for the KPNA2 antibody.

This KPNA2 antibody is available for research use only.

Antigen affinity

Human

P52292