Ku70 Antibody / XRCC6

Contact us
NSJ Bioreagents
Product Code: NSJ-R31952
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31952-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Ku70 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human 1) A549, 2) HeLa, 3) HePG2 and 4) MCF7 lysate with Ku70 antibody. Predicted/observed molecular weight ~70 kDa.
2 / 4
IHC testing of FFPE human tonsil with Ku70 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
Flow cytometry testing of human SiHa cells with Ku70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70 antibody.
4 / 4
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
❮❯

Western blot testing of human 1) A549, 2) HeLa, 3) HePG2 and 4) MCF7 lysate with Ku70 antibody. Predicted/observed molecular weight ~70 kDa.
IHC testing of FFPE human tonsil with Ku70 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human SiHa cells with Ku70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence: 2-4ug/ml
Application Note:
Optimal dilution of the Ku70 antibody should be determined by the researcher.
Description:
XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD of human Ku70 were used as the immunogen for the Ku70 antibody.
Limitation:
This Ku70 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P12956