LCK Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R31894
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31894-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the LCK antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 7
Western blot testing of 1) human Jurkat, 2) rat thymus, 3) rat spleen, 4) mouse thymus and 5) mouse spleen lysate with LCK antibody. Expected/observed molecular weight ~58 kDa.
2 / 7
IHC testing of FFPE human tonsil with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 7
IHC testing of FFPE mouse lymph node with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 7
IHC testing of FFPE rat lymph node with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 7
IHC staining of frozen mouse spleen tissue with LCK antibody.
6 / 7
IF/ICC staining of FFPE human U-2 OS cells with LCK antibody (clone red) and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
7 / 7
Flow cytometry testing of human HepG2 cells with LCK antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= LCK antibody.
❮❯

Western blot testing of 1) human Jurkat, 2) rat thymus, 3) rat spleen, 4) mouse thymus and 5) mouse spleen lysate with LCK antibody. Expected/observed molecular weight ~58 kDa.
IHC testing of FFPE human tonsil with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse lymph node with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat lymph node with LCK antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of frozen mouse spleen tissue with LCK antibody.
IF/ICC staining of FFPE human U-2 OS cells with LCK antibody (clone red) and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human HepG2 cells with LCK antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= LCK antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunocytochemistry: 2-4ug/ml,Flow cytometry: 1-3ug/10^6 cells
Application Note:
Optimal dilution of the LCK antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Lck (or lymphocyte-specific protein tyrosine kinase) is a protein found inside specialized cells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ of human Lymphocyte-specific protein tyrosine kinase were used as the immunogen for the LCK antibody.
Limitation:
This LCK antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P06239