MC3R Antibody / MC3 Receptor
| Code | Size | Price |
|---|
| NSJ-R32721-100ug | 100ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
Application: Western Blot (WB)
Storage:
After reconstitution, the MC3 Receptor antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the MC3 Receptor antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 91-121 (NALETIMIAIVHSDYLTFEDQFIQHMDNIFD) from the human protein were used as the immunogen for the MC3 Receptor antibody.
Limitation:
This MC3 Receptor antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
P41968