MLH1 Antibody
| Code | Size | Price |
|---|
| NSJ-R32088-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the MLH1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the MLH1 antibody should be determined by the researcher.
Description:
MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC of human MLH1 were used as the immunogen for the MLH1 antibody.
Limitation:
This MLH1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P40692