MMP8 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32022
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32022-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the MMP-8 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human 1) K562 and 2) Jurkat cell lysate with MMP-8 antibody. Expected molecular weight: 55 kDa (latent), 46, 42 kDa (active).~
2 / 2
IHC testing of FFPE human appendicitis tissue with MMP-8 antibody. HIER: Boil the paraffin secti
❮❯

Western blot testing of human 1) K562 and 2) Jurkat cell lysate with MMP-8 antibody. Expected molecular weight: 55 kDa (latent), 46, 42 kDa (active).~
IHC testing of FFPE human appendicitis tissue with MMP-8 antibody. HIER: Boil the paraffin secti

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the MMP-8 antibody should be determined by the researcher.
Description:
MMP-8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP-8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQ of human MMP8 were used as the immunogen for the MMP-8 antibody.
Limitation:
This MMP-8 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P22894