Monoamine Oxidase B Antibody / MAOB

Contact us
NSJ Bioreagents
Product Code: NSJ-R32040
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32040-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the MAOB antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of 1) rat heart, 2) rat kidney, 3) rat intestine, 4) mouse kidney, 5) mouse intestine, 6) mouse heart, 7) Human HepG2, 8) human HeLa and 9) human COLO320 lysate with MAOB antibody. Expected/observed molecular weight ~59 kDa.
2 / 4
IHC testing of FFPE human lung cancer with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE mouse intestine with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
IHC testing of FFPE rat intestine with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of 1) rat heart, 2) rat kidney, 3) rat intestine, 4) mouse kidney, 5) mouse intestine, 6) mouse heart, 7) Human HepG2, 8) human HeLa and 9) human COLO320 lysate with MAOB antibody. Expected/observed molecular weight ~59 kDa.
IHC testing of FFPE human lung cancer with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with MAOB antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the MAOB antibody should be determined by the researcher.
Description:
Monoamine oxidase B, also called MAO, BRAIN, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER of human MAOB were used as the immunogen for the MAOB antibody.
Limitation:
This MAOB antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P27338