MUC2 Antibody / Mucin 2

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4080
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4080-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
After reconstitution, the Mucin 2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 8
IHC testing of FFPE human rectal cancer tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
2 / 8
IHC testing of FFPE human colon cancer tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
3 / 8
IHC testing of FFPE mouse colon tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
4 / 8
IHC testing of FFPE rat colon tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
5 / 8
Immunofluorescent staining of FFPE human ileum with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
6 / 8
Immunofluorescent staining of FFPE human colon with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
7 / 8
Immunofluorescent staining of FFPE mouse ileum with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
8 / 8
Immunofluorescent staining of FFPE mouse colon with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
❮❯

IHC testing of FFPE human rectal cancer tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human colon cancer tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse colon tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat colon tissue with Mucin-2 antibody at 1ug/ml. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
Immunofluorescent staining of FFPE human ileum with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human colon with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE mouse ileum with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE mouse colon with Mucin-2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

Documents

Further Information

Application Details :
Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5-7ug/ml
Application Note:
Optimal dilution of the Mucin 2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80% by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD from the human protein were used as the immunogen for the Mucin 2 antibody.
Limitation:
This Mucin 2 antibody is available for research use only.
Localization:
Secreted
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q02817