MUC3 Antibody
| Code | Size | Price |
|---|
| NSJ-R32385-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the MUC3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the MUC3 antibody should be determined by the researcher.
Description:
MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E. coli or enterohemorrhage E. coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody.
Limitation:
This MUC3 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q02505