MVD Antibody / Mevalonate pyrophosphate decarboxylase

NSJ Bioreagents
Product Code: NSJ-RQ4089
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4089-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the MVD antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human HepG2 cell lysate with MVD antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.

Western blot testing of human HepG2 cell lysate with MVD antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the MVD antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The enzyme mevalonate pyrophosphate decarboxylase (MVD; EC 4.1.1.33) catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate. This unusual enzyme decarboxylates and dehydrates its substrate while hydrolyzing ATP. As a unique enzyme in one of the early steps in cholesterol biosynthesis, MVD may be a useful target for drugs aimed at lowering serum cholesterol levels. This gene is mapped to chromosome 16q24.3 based on an alignment of the MVDsequence.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KDFTEDRIWLNGREEDVGQPRLQACLREIRCLARKRR from the human protein were used as the immunogen for the MVD antibody.
Limitation:
This MVD antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
P53602