NARG1 Antibody / NAA15
| Code | Size | Price |
|---|
| NSJ-R32787-100ug | 100ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
Applications:
- Immunohistochemistry- Paraffin Embedded (IHC-P)
- Western Blot (WB)
Storage:
After reconstitution, the NARG1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the NARG1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (N-alpha-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 244-287 (ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY) from the human protein were used as the immunogen for the NARG1 antibody.
Limitation:
This NARG1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
Q9BXJ9