NFIA Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32548
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32548-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the NFIA antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 8
Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
2 / 8
Western blot testing of mouse 1) HEPA1-6 and 2) SP2/0 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
3 / 8
IHC testing of FFPE human breast cancer tissue with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
4 / 8
IHC testing of FFPE mouse liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
5 / 8
IHC testing of FFPE rat liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
6 / 8
Flow cytometry testing of human K562 cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
7 / 8
Flow cytometry testing of human U-2 OS cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
8 / 8
Flow cytometry testing of human SiHa cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
❮❯

Western blot testing of human 1) Jurkat and 2) COLO320 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
Western blot testing of mouse 1) HEPA1-6 and 2) SP2/0 lysate with NFIA antibody at 0.5ug/ml. Predicted molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
IHC testing of FFPE human breast cancer tissue with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat liver with NFIA antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human K562 cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
Flow cytometry testing of human U-2 OS cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.
Flow cytometry testing of human SiHa cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NFIA antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 180-224 (AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) from the human protein were used as the immunogen for the NFIA antibody.
Limitation:
This NFIA antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q12857