NOX4 Antibody / NADPH oxidase 4

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4166
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4166-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the NADPH oxidase 4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) HeLa, 2) MCF7, 3) HepG2, 4) A549 and 5) 293T cell lysate with NADPH oxidase 4 antibody at 0.5ug/ml. Expected molecular weight: ~65 kDa, 75-80 kDa.
2 / 3
Western blot testing of 1) rat kidney, 2) rat NRK, 3) mouse kidney, 4) mouse HEPA1-6 and 5) mouse SP20 lysate with NADPH oxidase 4 antibody at 0.5ug/ml. Expected molecular weight: ~65 kDa, 75-80 kDa.
3 / 3
IHC testing of FFPE human renal cancer tissue with NADPH oxidase 4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
❮❯

Western blot testing of human 1) HeLa, 2) MCF7, 3) HepG2, 4) A549 and 5) 293T cell lysate with NADPH oxidase 4 antibody at 0.5ug/ml. Expected molecular weight: ~65 kDa, 75-80 kDa.
Western blot testing of 1) rat kidney, 2) rat NRK, 3) mouse kidney, 4) mouse HEPA1-6 and 5) mouse SP20 lysate with NADPH oxidase 4 antibody at 0.5ug/ml. Expected molecular weight: ~65 kDa, 75-80 kDa.
IHC testing of FFPE human renal cancer tissue with NADPH oxidase 4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the NADPH oxidase 4 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL were used as the immunogen for the NADPH oxidase 4 antibody.
Limitation:
This NADPH oxidase 4 antibody is available for research use only.
Localization:
Cytoplasmic and cell surface
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9NPH5