OGT Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R31809
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31809-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the OGT antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 9
Immunofluorescent staining of FFPE human A431 cells with OGT antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 9
IHC testing of FFPE mouse intestine with OGT antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 9
IHC testing of FFPE rat intestine with OGT antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 9
IHC testing of FFPE rat pancreas with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
5 / 9
IHC testing of FFPE human stomach cancer with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
6 / 9
IHC testing of FFPE human pancreatic cancer with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
7 / 9
Western blot testing of human 1) HeLa, 2) PC-3, 3) A431, 4) A549, 5) Caco-2, 6) K562, 7) rat heart and 8) mouse heart lysate with OGT antibody. Expected molecular weight 110-117 kDa.
8 / 9
Flow cytometry testing of human U937 cells with OGT antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= OGT antibody.
9 / 9
Flow cytometry testing of mouse RAW264.7 cells with OGT antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= OGT antibody.
❮❯

Immunofluorescent staining of FFPE human A431 cells with OGT antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse intestine with OGT antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with OGT antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat pancreas with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human stomach cancer with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human pancreatic cancer with OGT antibody. HIER: Boil the paraffin sections in pH8 EDTA for 20 minutes and allow to cool prior to staining.
Western blot testing of human 1) HeLa, 2) PC-3, 3) A431, 4) A549, 5) Caco-2, 6) K562, 7) rat heart and 8) mouse heart lysate with OGT antibody. Expected molecular weight 110-117 kDa.
Flow cytometry testing of human U937 cells with OGT antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= OGT antibody.
Flow cytometry testing of mouse RAW264.7 cells with OGT antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= OGT antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the OGT antibody should be determined by the researcher.
Description:
O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA of human OGT were used as the immunogen for the OGT antibody.
Limitation:
This OGT antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O15294