P2RY5 Antibody / P2Y Purinoceptor 5 / LPAR6

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4219
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4219-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the P2RY5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) MCF7, 2) HepG2 and 3) SK-OV-3 cell lysate with P2RY5 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
2 / 3
Flow cytometry testing of human A549 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.
3 / 3
Flow cytometry testing of human PC-3 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.
❮❯

Western blot testing of human 1) MCF7, 2) HepG2 and 3) SK-OV-3 cell lysate with P2RY5 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Flow cytometry testing of human A549 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.
Flow cytometry testing of human PC-3 cells with P2RY5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P2RY5 antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the P2RY5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Lysophosphatidic acid receptor 6 also known as LPA6, P2RY5, and GPR87, is a protein that in humans is encoded by the LPAR6 gene. The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. This gene aligns with an internal intron of the retinoblastoma susceptibility gene in the reverse orientation. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLK were used as the immunogen for the P2RY5 antibody.
Limitation:
This P2RY5 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Species Reactivity (Predicted):
Mouse, Rat
Uniprot #:
P43657