p95 NBS1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R31829
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31829-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunocytochemistry (ICC)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the p95 NBS1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) rat testis, 2) rat brain, 3) rat liver, 4) mouse testis, 5) human HeLa, 6) A431, and 7) HUT lysate with p95 NBS1 antibody. Predicted/observed molecular weight ~95 kDa.
2 / 5
IHC testing of FFPE human breast cancer with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
ICC testing of FFPE human A549 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
ICC testing of FFPE human SW480 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 5
ICC testing of FFPE human SMMC-7781 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of 1) rat testis, 2) rat brain, 3) rat liver, 4) mouse testis, 5) human HeLa, 6) A431, and 7) HUT lysate with p95 NBS1 antibody. Predicted/observed molecular weight ~95 kDa.
IHC testing of FFPE human breast cancer with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC testing of FFPE human A549 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC testing of FFPE human SW480 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC testing of FFPE human SMMC-7781 cells with p95 NBS1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,ICC (Paraffin): 0.5-1ug/ml
Application Note:
Optimal dilution of the p95 NBS1 antibody should be determined by the researcher.
Description:
p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50 (N/M/R or MRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RKNTELEEWLRQEMEVQNQHAKEESLADDLFR of human p95 NBS1 were used as the immunogen for the p95 NBS1 antibody.
Limitation:
This p95 NBS1 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O60934