PC4 Antibody / Positive cofactor 4

NSJ Bioreagents
Product Code: NSJ-R32566
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32566-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PC4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) rat liver, 2) rat spleen, 3) rat stomach, 4) rat RH35, 5) mouse liver and 6) mouse spleen tissue lysate with PC4 antibody. Expected molecular weight: 15-19 kDa (unmodified) and ~26 kDa (phosphorylated).
2 / 5
Western blot testing of human 1) HeLa, 2) A549, 3) MCF7, 4) T-47D, 5) PC-3, 6) Jurkat, 7) human placenta and 8) HL60 cell lysate with PC4 antibody. Expected molecular weight: 15-19 kDa (unmodified) and ~26 kDa (phosphorylated).
3 / 5
Immunofluorescent staining of FFPE human intestinal cancer tissue with PC4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 ETDA for 20 min.
4 / 5
IHC staining of FFPE type 1 human endometrioid adenocarcinoma tissue with PC4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 5
IHC staining of FFPE human esophageal squamous carcinoma tissue with PC4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Western blot testing of 1) rat liver, 2) rat spleen, 3) rat stomach, 4) rat RH35, 5) mouse liver and 6) mouse spleen tissue lysate with PC4 antibody. Expected molecular weight: 15-19 kDa (unmodified) and ~26 kDa (phosphorylated).
Western blot testing of human 1) HeLa, 2) A549, 3) MCF7, 4) T-47D, 5) PC-3, 6) Jurkat, 7) human placenta and 8) HL60 cell lysate with PC4 antibody. Expected molecular weight: 15-19 kDa (unmodified) and ~26 kDa (phosphorylated).
Immunofluorescent staining of FFPE human intestinal cancer tissue with PC4 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 ETDA for 20 min.
IHC staining of FFPE type 1 human endometrioid adenocarcinoma tissue with PC4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human esophageal squamous carcinoma tissue with PC4 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Activated RNA polymerase II transcriptional coactivator p15, also known as Positive cofactor 4 (PC4) or SUB1 homolog, is a protein that in humans is encoded by the SUB1 gene. This gene is mapped to 5p13.3. The transcriptional cofactor PC4 is an ancient single-strand DNA (ssDNA)-binding protein that has a homologue in bacteriophage T5 where it is likely the elusive replicative ssDNA-binding protein. The recombinant PC4 is shown to function identically to the native protein through its interaction with TAFs.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 96-127 (MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL) from the human protein were used as the immunogen for the PC4 antibody.
Limitation:
This PC4 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P53999