Periplakin Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32647
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32647-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Periplakin antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 7
IHC testing of FFEP human tonsil tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
2 / 7
IHC testing of FFEP human tonsil tissue with Periplakin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 7
IHC testing of FFEP human esophagus squama cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
4 / 7
IHC testing of FFEP human lung cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
5 / 7
Immunofluorescent staining of FFPE human A431 cells with Periplakin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
6 / 7
Western blot testing of human 1) HeLa, 2) A549, 3) SW620, 4) HepG2, 5) SK-O-V3, 6) PANC-1, 7) SGC-7801, 8) rat lung and 9) mouse lung lysate with Periplakin antibody at 0.5ug/ml. Predicted molecular weight ~205 kDa.
7 / 7
Flow cytometry testing of human U-2 OS cells with Periplakin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Periplakin antibody.
❮❯

IHC testing of FFEP human tonsil tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFEP human tonsil tissue with Periplakin antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFEP human esophagus squama cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
IHC testing of FFEP human lung cancer tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.
Immunofluorescent staining of FFPE human A431 cells with Periplakin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) A549, 3) SW620, 4) HepG2, 5) SK-O-V3, 6) PANC-1, 7) SGC-7801, 8) rat lung and 9) mouse lung lysate with Periplakin antibody at 0.5ug/ml. Predicted molecular weight ~205 kDa.
Flow cytometry testing of human U-2 OS cells with Periplakin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Periplakin antibody.

Documents

Further Information

Application Details :
Western blot: 0.25-0.5ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Periplakin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.
Limitation:
This Periplakin antibody is available for research use only.
Localization:
Cytoplasmic, membranous, nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O60437