Peroxiredoxin 4 Antibody / PRDX4

Contact us
NSJ Bioreagents
Product Code: NSJ-R32208
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32208-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunocytochemistry (ICC)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Peroxiredoxin 4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with Peroxiredoxin 4 antibody. Expected/observed molecualr weight ~31 kDa.
2 / 5
IHC testing of FFPE human tonsil with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
IHC testing of FFPE mouse brain with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
IHC testing of FFPE rat brain with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 5
ICC testing of human A549 cells with Peroxiredoxin 4 antibody.
❮❯

Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with Peroxiredoxin 4 antibody. Expected/observed molecualr weight ~31 kDa.
IHC testing of FFPE human tonsil with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse brain with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with Peroxiredoxin 4 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC testing of human A549 cells with Peroxiredoxin 4 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunocytochemistry: 0.5-1ug/ml
Application Note:
Optimal dilution of the Peroxiredoxin 4 antibody should be determined by the researcher.
Description:
PRDX4 (Peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK of human Peroxiredoxin 4 were used as the immunogen for the Peroxiredoxin 4 antibody.
Limitation:
This Peroxiredoxin 4 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q13162