PGP9.5 / UchL1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R31930
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31930-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PGP 9.5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 6
Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.
2 / 6
IHC testing of FFPE human glioma tissue with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 6
IHC testing of FFPE mouse brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 6
IHC testing of FFPE rat brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 6
Immunofluorescent staining of human SH-SY5Y cells with PGP 9.5 antibody (green) and DAPI nuclear stain (blue).
6 / 6
Flow cytometry testing of human K562 cells with PGP 9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP 9.5 antibody.
❮❯

Western blot testing of 1) rat brain, 2) mouse brain and 3) human U87 lysate with PGP 9.5 antibody. Expected/observed molecular weight ~25 kDa.
IHC testing of FFPE human glioma tissue with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with PGP 9.5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human SH-SY5Y cells with PGP 9.5 antibody (green) and DAPI nuclear stain (blue).
Flow cytometry testing of human K562 cells with PGP 9.5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PGP 9.5 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/10^6 cells
Application Note:
Optimal dilution of the PGP 9.5 antibody should be determined by the researcher.
Description:
UchL1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UchL1/PGP9.5 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UchL1/PGP9.5 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR of human PGP9.5 were used as the immunogen for the PGP 9.5 antibody.
Limitation:
This PGP 9.5 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P09936