PI3K p110 Antibody (beta)

Contact us
NSJ Bioreagents
Product Code: NSJ-R32723
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32723-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PI3K p110 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of 1) rat liver, 2) rat kidney, 3) mouse spleen, 4) mouse thymus, 5) human MCF7 and 6) human K562 lysate with PI3K p110 antibody at 0.5ug/ml. Expected molecular weight ~110 kDa.
2 / 3
IHC testing of FFPE human intestinal cancer tissue with PI3K p110 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 3
IHC testing of FFPE human lung cancer tissue with PI3K p110 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
❮❯

Western blot testing of 1) rat liver, 2) rat kidney, 3) mouse spleen, 4) mouse thymus, 5) human MCF7 and 6) human K562 lysate with PI3K p110 antibody at 0.5ug/ml. Expected molecular weight ~110 kDa.
IHC testing of FFPE human intestinal cancer tissue with PI3K p110 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with PI3K p110 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the PI3K p110 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform is an enzyme that in humans is encoded by the PIK3CB gene. This gene encodes an isoform of the catalytic subunit of phosphoinositide 3-kinase (PI3K). These kinases are important in signaling pathways involving receptors on the outer membrane of eukaryotic cells and are named for their catalytic subunit. The encoded protein is the catalytic subunit for PI3Kbeta (PI3KB). PI3KB has been shown to be part of the activation pathway in neutrophils which have bound immune complexes at sites of injury or infection. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 556-598 (DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW) from the human protein were used as the immunogen for the PI3K p110 antibody.
Limitation:
This PI3K p110 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P42338