PML Antibody / Promyelocytic leukemia protein

Contact us
NSJ Bioreagents
Product Code: NSJ-R32552
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32552-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PML antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
2 / 3
IHC testing of FFPE human intestinal cancer tissue with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 3
Flow cytometry testing of human A431 cells with PML antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PML antibody.
❮❯

Western blot testing of human 1) SW620 and 2) U-2 OS lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
IHC testing of FFPE human intestinal cancer tissue with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with PML antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PML antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the protein's central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 141-179 (FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD) from the human protein were used as the immunogen for the PML antibody.
Limitation:
This PML antibody is available for research use only.
Localization:
Nuclear, cytoplasmic (isoform dependent)
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P29590