PSMA2 Antibody / Proteasome 20S alpha 2

Western blot: 0.5-1ug/ml

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.

Antigen affinity purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Amino acids 82-123 (DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQ) from the human protein were used as the immunogen for the PSMA2 antibody.

This PSMA2 antibody is available for research use only.

Cytoplasmic, nuclear

Antigen affinity

Human, Rat

P25787