PTP4A2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32207
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32207-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PTP4A2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
2 / 5
Western blot testing of 1) human MOLT-4, 2) human T-47D, 3) human Daudi, 4) human RT4 and 5) rat PC-12 cell lysate with PTP4A2 antibody. Expected molecular weight ~19 kDa.
3 / 5
Flow cytometry testing of human A431 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
4 / 5
Flow cytometry testing of human U937 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
5 / 5
Flow cytometry testing of human PC-3 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
❮❯

IHC testing of FFPE human prostate cancer with PTP4A2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human MOLT-4, 2) human T-47D, 3) human Daudi, 4) human RT4 and 5) rat PC-12 cell lysate with PTP4A2 antibody. Expected molecular weight ~19 kDa.
Flow cytometry testing of human A431 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
Flow cytometry testing of human U937 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.
Flow cytometry testing of human PC-3 cells with PTP4A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=PTP4A2 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PTP4A2 antibody should be determined by the researcher.
Description:
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TTLVRVCDATYDKAPVEKEGIHVLDWPFDD of human PTP4A2 were used as the immunogen for the PTP4A2 antibody.
Limitation:
This PTP4A2 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q12974