RanBP2 Antibody (C-Terminal Region)

Western Blot: 0.5-1ug/ml

Optimal dilution of the RanBP2 antibody should be determined by the researcher.

Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

RAN binding protein 2 (RANBP2), also called NUP358 is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

Antigen affinity purified

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Amino acids 3018-3057 (EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE) were used as the immunogen for the RanBP2 antibody.

This RanBP2 antibody is available for research use only.

Antigen affinity

Mouse, Rat

Human

P49792