RENT1 / hUPF1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32296
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32296-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the UPF1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 6
Immunofluorescent staining of FFPE human A431 cells with UPF1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC testing of FFPE human intestinal cancer tissue with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 6
IHC testing of FFPE mouse intestine with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 6
IHC testing of FFPE rat intestine with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 6
Western blot testing of human 1) HeLa, 2) Raji, 3) HepG2, 4) SK-OV-3, 5) PC-3, 6) HEK293, 7) rat RH35 and 8) mouse HEPA1-6 cell lysate with UPF1 antibody. Predicted molecular weight ~124 kDa, but routinely observed at 130-140 kDa.
6 / 6
Flow cytometry testing of human PC-3 cells with UPF1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UPF1 antibody.
❮❯

Immunofluorescent staining of FFPE human A431 cells with UPF1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer tissue with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with UPF1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of human 1) HeLa, 2) Raji, 3) HepG2, 4) SK-OV-3, 5) PC-3, 6) HEK293, 7) rat RH35 and 8) mouse HEPA1-6 cell lysate with UPF1 antibody. Predicted molecular weight ~124 kDa, but routinely observed at 130-140 kDa.
Flow cytometry testing of human PC-3 cells with UPF1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UPF1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the UPF1 antibody should be determined by the researcher.
Description:
Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. And this protein is located only in the cytoplasm. When translation ends, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted for this gene. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE of human UPF1 were used as the immunogen for the UPF1 antibody.
Limitation:
This UPF1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q92900