SECTM1 Antibody

NSJ Bioreagents
Product Code: NSJ-R32327
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32327-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Mouse
Application: Western Blot (WB)
Storage:
After reconstitution, the SECTM1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.

Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the SECTM1 antibody should be determined by the researcher.
Description:
SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.
Limitation:
This SECTM1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Mouse
Uniprot #:
Q9JL59