SFTPB Antibody / Pulmonary surfactant-associated protein B
Code | Size | Price |
---|
NSJ-RQ4213-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the SFTPB antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the SFTPB antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody.
Limitation:
This SFTPB antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Species Reactivity (Predicted):
Mouse, Rat
Uniprot #:
P07988