SHIP1 Antibody
Code | Size | Price |
---|
NSJ-RQ4421-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
- Rat
Applications:
- Immunohistochemistry- Paraffin Embedded (IHC-P)
- Western Blot (WB)
Storage:
After reconstitution, the SHIP1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the SHIP1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, also called Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145 and SH2 domain-containing inositol phosphatase 1 (SHIP1), is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ from the human protein were used as the immunogen for the SHIP1 antibody.
Limitation:
This SHIP1 antibody is available for research use only.
Localization:
Membrane, cytoplasm
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q92835