SLC10A1 Antibody / NTCP

Contact us
NSJ Bioreagents
Product Code: NSJ-R31795
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31795-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Frozen Section (IHC-F)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the NTCP antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 9
Western blot testing of 1) rat liver and 2) mouse liver lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
2 / 9
IHC testing of FFPE human liver cancer tissue with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 9
IHC testing of FFPE mouse liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 9
IHC testing of FFPE rat liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 9
IHC testing of frozen mouse liver tissue with NTCP antibody.
6 / 9
Flow cytometry testing of Buffalo rat liver (BRL 3A) cells with NTCP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NTCP antibody.
7 / 9
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (green) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
8 / 9
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (red) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
9 / 9
Western blot testing of 1) rat liver and 2) rat kidney lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
❮❯

Western blot testing of 1) rat liver and 2) mouse liver lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.
IHC testing of FFPE human liver cancer tissue with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat liver with NTCP antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of frozen mouse liver tissue with NTCP antibody.
Flow cytometry testing of Buffalo rat liver (BRL 3A) cells with NTCP antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=NTCP antibody.
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (green) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Immunofluorescent staining of FFPE mouse liver with NTCP antibody (red) and DAPI nuclear counterstain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) rat liver and 2) rat kidney lysate with SLC10A1 antibody. Expected molecular weight: 38~45 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunohistochemistry (Frozen): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the NTCP antibody should be determined by the researcher.
Description:
Na+-taurocholate cotransporting polypeptide (NTCP), also known as SLC10A1 (Solute carrier family 10, member 1), is the major bile acid uptake system in human hepatocytes. NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids. The hASBT gene is known to be activated by the glucocorticoid receptor (GR). Ho RH et al. indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody.
Limitation:
This NTCP antibody is available for research use only.
Localization:
Membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O08705