SLC7A3 Antibody (N-Terminal)

NSJ Bioreagents
Product Code: NSJ-R32985
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32985-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the SLC7A3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human A431 cell lysate with SLC7A3 antibody at 0.5ug/ml. Predicted molecular weight ~67 kDa.

Western blot testing of human A431 cell lysate with SLC7A3 antibody at 0.5ug/ml. Predicted molecular weight ~67 kDa.

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the SLC7A3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 1-30 (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) were used as the immunogen for the SLC7A3 antibody.
Limitation:
This SLC7A3 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q8WY07