SMC3 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32356
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32356-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SMC3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of 1) rat brain, 2) rat liver, 3) rat testis, 4) human HeLa, 5) human A549, 6) human MCF7 and 7) mouse NIH3T3 lysate with SMC3 antibody. Exepcted/observed molecular weight ~141 kDa.
2 / 4
IHC testing of FFPE human intestinal cancer tissue with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE mouse intestine with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
IHC testing of FFPE rat kidney with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of 1) rat brain, 2) rat liver, 3) rat testis, 4) human HeLa, 5) human A549, 6) human MCF7 and 7) mouse NIH3T3 lysate with SMC3 antibody. Exepcted/observed molecular weight ~141 kDa.
IHC testing of FFPE human intestinal cancer tissue with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat kidney with SMC3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the SMC3 antibody should be determined by the researcher.
Description:
Structural maintenance of chromosomes 3 belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH of human SMC3 were used as the immunogen for the SMC3 antibody.
Limitation:
This SMC3 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UQE7