SMYD3 Antibody

NSJ Bioreagents
Product Code: NSJ-R32321
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32321-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SMYD3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human 1) HeLa and 2) COLO320 cell lysate with SMYD3 antibody. Expected molecular weight ~49 kDa.~
2 / 2
IHC testing of FFPE human intestinal cancer tissue with SMYD3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrat

Western blot testing of human 1) HeLa and 2) COLO320 cell lysate with SMYD3 antibody. Expected molecular weight ~49 kDa.~
IHC testing of FFPE human intestinal cancer tissue with SMYD3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrat

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the SMYD3 antibody should be determined by the researcher.
Description:
SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS of human SMYD3 were used as the immunogen for the SMYD3 antibody.
Limitation:
This SMYD3 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q9H7B4