Sp5 Antibody

NSJ Bioreagents
Product Code: NSJ-R32265
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32265-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Sp5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human MCF7 cell lysate with Sp5 antibody. Expected/observed molecular weight ~42 kDa.~
2 / 2
IHC testing of FFPE human placenta with Sp5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and a

Western blot testing of human MCF7 cell lysate with Sp5 antibody. Expected/observed molecular weight ~42 kDa.~
IHC testing of FFPE human placenta with Sp5 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and a

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the Sp5 antibody should be determined by the researcher.
Description:
Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.
Limitation:
This Sp5 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q6BEB4