StAR Antibody / Steroidogenic acute regulatory protein
| Code | Size | Price |
|---|
| NSJ-RQ4391-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Mouse
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the StAR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the StAR antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The steroidogenic acute regulatory protein, commonly referred to as StAR (STARD1), is a transport protein. This protein plays a key role in the acute regulation of steroid hormone synthesis by enhancing the conversion of cholesterol into pregnenolone. It permits the cleavage of cholesterol into pregnenolone by mediating the transport of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane. Mutations in this gene are a cause of congenital lipoid adrenal hyperplasia (CLAH), also called lipoid CAH. A pseudogene of this gene is located on chromosome 13.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQD from the human protein were used as the immunogen for the StAR antibody.
Limitation:
This StAR antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Mouse, Rat
Species Reactivity (Predicted):
Human
Uniprot #:
P49675