STAT1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32095
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32095-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the STAT1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of rat 1) testis, 2) brain, 3) liver, and human 4) placenta, 5) MCF7, and 6) SW620 lysate with STAT1 antibody. Predicted/observed molecular weight: ~91/84 kDa (alpha/beta).
2 / 4
IHC testing of FFPE human breast cancer with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE mouse intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
IHC testing of FFPE rat intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of rat 1) testis, 2) brain, 3) liver, and human 4) placenta, 5) MCF7, and 6) SW620 lysate with STAT1 antibody. Predicted/observed molecular weight: ~91/84 kDa (alpha/beta).
IHC testing of FFPE human breast cancer with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with STAT1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the STAT1 antibody should be determined by the researcher.
Description:
The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KILENAQRFNQAQSGNIQSTVMLDKQKELD of human STAT1 were used as the immunogen for the STAT1 antibody.
Limitation:
This STAT1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P42224