STAT2 Antibody
| Code | Size | Price |
|---|
| NSJ-RQ4293-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Mouse
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the STAT2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the STAT2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Signal transducer and activator of transcription 2 is a protein that in humans is encoded by the STAT2 gene. The protein encoded by this gene is a member of the STAT protein family. The International Radiation Hybrid Mapping Consortium mapped the STAT2 gene to chromosome 12. STAT2 is a transcription factor critical to the signal transduction pathway of type I interferons. ISGF3 (STAT2) assembly involves p48 functioning as an adaptor protein to recruit Stat1 and Stat2 to an IFN-alpha-stimulated response element, Stat2 contributes a potent transactivation domain but is unable to directly contact DNA, while Stat1 stabilizes the heteromeric complex by contacting DNA directly.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids FQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEA were used as the immunogen for the STAT2 antibody.
Limitation:
This STAT2 antibody is available for research use only.
Localization:
Cytoplasm, nucleus
Purity:
Antigen affinity purified
Species Reactivity :
Mouse, Rat
Species Reactivity (Predicted):
Human
Uniprot #:
P52630