STAT6 Antibody
| Code | Size | Price |
|---|
| NSJ-R32096-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the STAT6 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the STAT6 antibody should be determined by the researcher.
Description:
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ESIYQRDPLKLVATFRQILQGEKKAVMEQFR of human STAT6 were used as the immunogen for the STAT6 antibody.
Limitation:
This STAT6 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P42226