SULT2A1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32194
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32194-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SULT2A1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
IHC testing of FFPE human renal cancer tissue with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
2 / 4
IHC testing of FFPE mouse liver with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE rat liver with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
Western blot testing of 1) human HCCT (hepatocellular carcinoma tumor), 2) human HCCP (hepatocellular carcinoma paracancerous), 3) human HepG2 and 4) rat liver lysate with SULT2A1 antibody. Expected molecular weight ~34 kDa.
❮❯

IHC testing of FFPE human renal cancer tissue with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse liver with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat liver with SULT2A1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human HCCT (hepatocellular carcinoma tumor), 2) human HCCP (hepatocellular carcinoma paracancerous), 3) human HepG2 and 4) rat liver lysate with SULT2A1 antibody. Expected molecular weight ~34 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the SULT2A1 antibody should be determined by the researcher.
Description:
Bile salt sulfotransferase, also known as hydroxysteroid sulfotransferase (HST) or sulfotransferase 2A1 (ST2A1), is an enzyme that in humans is encoded by the SULT2A1 gene. It is mapped to 19q13.3. This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE of human SULT2A1 were used as the immunogen for the SULT2A1 antibody.
Limitation:
This SULT2A1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q06520